{"method": "SOLUTION NMR", "mutation_s_field": "No", "ec_number": "", "description": "Anastellin is a carboxy-terminal fragment of the first FN3 domain from human fibronectin. It is capable of polymerizing fibronectin in vitro, and it displays anti-tumor, anti-metastatic and anti-angiogenic properties in vivo. However, its hydrophobic core becomes solvent-accessible and some of its Beta-strands lose their protection against hydrogen bonding to Beta-strands from other molecules. These features seem to be relevant for the fibronectin polymerization activity of anastellin and resemble the characteristics of amyloid fibril precursors.", "ligstr": "", "pmid": "12946358", "remarks": "Anastellin, an FN3 fragment with fibronectin polymerization activity, resembles amyloid fibril precursors", "amyloid_non_amyloid": "Amyloid", "type": "Protein", "inchi": "", "resolution": "", "species": "Homo sapiens", "secondary_structure": "MRGSNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPGSRSHHHHHH#CCCCCCSSCSSCSEEEEEEEETTTTCCCEEEEECSSSSCCCCCCCCTTCCEEEEEEEECTTSCCCEEEEEECSSSSCCCSCCCCCSSCC", "chain_id": "", "gene_names": "FN1, FN", "r_value_free": "", "pdb_id": "1Q38", "reference": "J Mol Biol. 2003 Sep 5;332(1):205-15", "keyword": "Fibronectin", "protein_name": "Fibronectin", "ligand_formula": "", "peptide_protein_sequence": "chain-ID A: MRGSNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPGSRSHHHHHH", "entry": "S-0052", "length": "89", "uniprot_ac": "P02751", "author": "Briknarova, K., Akerman, M.E., Hoyt, D.W., Ruoslahti, E., Ely, K.R.", "ligand_smiles": "", "ligand_mw": "", "alternative_name": "Cold-insoluble globulin", "ligand_name": "", "pdb_classification": "CELL ADHESION", "global_stoichiometry": "Monomer - A", "inchi_key": "", "ligand_id": ""}