{"resolution": "2.2", "ligand_mw": "24.31", "secondary_structure": "MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVAILGLMVLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA#CEEEEEEEEECTTCCHHHHHHHHHHHHHHHHHTTCEEEEEEEEEEEECCSSCCSSCEEEEEEEEEEECGGGHHHHHHHHHTSTTEEEEEEEECCCCCCCCC", "inchi": "InChI=1S/Mg/q+2", "method": "X-RAY DIFFRACTION", "ec_number": "", "uniprot_ac": "P23370", "remarks": "Engineered version of the ribosomal protein S6; EA41/EI42/RM46/RV47 (S6-Alz) ", "description": "S6-Alz displays complex reversible aggregation in the refolding process and is disposed to form soluble aggregates in its folded state. The crystal structure of S6-Alz shows that the mutated protein assembles into tetramers joined by intermolecular Beta-sheets involving the Beta-AP sequence. Peptides encompassing the engineered sequence readily form fibrils, suggesting a link between transient aggregation, tetramerization, and fibrillation. The onset of aggregation is linked to the deletion of charged residues, which leaves contiguous hydrophobic stretches in the protein's primary sequence.", "type": "Protein", "ligand_smiles": "[Mg+2]", "chain_id": "A", "species": "Thermus thermophilus", "keyword": "30S ribosomal protein S6", "ligstr": "MG:A:Mg 2:24.31:MAGNESIUM ION:[Mg+2]:InChI=1S/Mg/q+2:JLVVSXFLKOJNIY-UHFFFAOYSA-N", "pmid": "10944185", "mutation_s_field": "E41A/E42I/R46M/R47V", "author": "Otzen, D.E., Kristensen, O., Oliveberg, M.", "pdb_id": "1QJH", "amyloid_non_amyloid": "Amyloid", "inchi_key": "JLVVSXFLKOJNIY-UHFFFAOYSA-N", "ligand_name": "MAGNESIUM ION", "ligand_formula": "Mg 2", "ligand_id": "MG", "r_value_free": "0.275", "protein_name": "30S ribosomal protein S6", "gene_names": "rpsF, rps6", "global_stoichiometry": "Homo 2-mer - A2", "alternative_name": "TS9", "peptide_protein_sequence": "chain-ID A: MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVAILGLMVLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA", "pdb_classification": "RIBOSOMAL PROTEIN", "reference": "Proc Natl Acad Sci U S A. 2000 Aug 29;97(18):9907-12", "length": "101", "entry": "S-0054"}