{"method": "SOLUTION NMR", "mutation_s_field": "No", "ec_number": "", "description": "Here, the structure and dynamics of micelle-bound Alpha-synuclein (aS) is reported. Val3-Val37 and Lys45-Thr92 form curved Alpha-helices, connected by a well ordered, extended linker in an unexpected anti-parallel arrangement, followed by another short extended region (Gly93-Lys97), overlapping the recently identified chaperone-mediated autophagy recognition motif and a highly mobile tail (Asp98-Ala140). Helix curvature is significantly less than predicted based on the native micelle shape, indicating a deformation of the micelle by aS. Structural and dynamic parameters show a reduced helical content for Ala30-Val37.", "ligstr": "", "pmid": "15615727", "remarks": "Human micelle-bound alpha-synuclein", "amyloid_non_amyloid": "Amyloid", "type": "Protein complex", "inchi": "", "resolution": "", "species": "Homo sapiens", "secondary_structure": "MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA#CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCCCSCCCCSCCCCCSSSSCSCCCBTTTBTTTSSCTTCCSSCSSCC", "chain_id": "", "gene_names": "SNCA, NACP, PARK1", "r_value_free": "", "pdb_id": "1XQ8", "reference": "J Biol Chem. 2005 Mar 11;280(10):9595-603. Epub  2004 Dec 22", "keyword": "Alpha-synuclein", "protein_name": "Alpha-synuclein", "ligand_formula": "", "peptide_protein_sequence": "chain-ID A: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA", "entry": "S-0073", "length": "140", "uniprot_ac": "P37840", "author": "Ulmer, T.S., Bax, A., Cole, N.B., Nussbaum, R.L.", "ligand_smiles": "", "ligand_mw": "", "alternative_name": "Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor", "ligand_name": "", "pdb_classification": "LIPID BINDING PROTEIN", "global_stoichiometry": "Monomer - A ", "inchi_key": "", "ligand_id": ""}