{"global_stoichiometry": "Monomer - A ", "ligstr": "", "uniprot_ac": "P61769", "inchi": "InChI=1S/Na/q+1", "reference": "J Biol Chem. 2006 Oct 13;281(41):31061-9. Epub  2006 Aug 10", "author": "Kihara, M., Chatani, E., Iwata, K., Yamamoto, K., Matsuura, T., Nakagawa, A., Naiki, H., Goto, Y.", "type": "Protein", "ligand_id": "", "species": "Homo sapiens", "method": "X-RAY DIFFRACTION", "keyword": "Beta-2-microglobulin", "gene_names": "B2M, CDABP0092, HDCMA22P", "chain_id": "A", "ligand_mw": "22.99", "inchi_key": "FKNQFGJONOIPTF-UHFFFAOYSA-N", "secondary_structure": "MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDWLKNGERIEKVEHSDLSFSKDFSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKFDRDM#CCCBCCEEEEEEECCGGGTTCCEEEEEEEEEBSSCCEEEEEETTEECCCCCEEEEEECTTCCEEEEEEEECCCCSSCCEEEEEECTTCSSCEEEECCCCC", "amyloid_non_amyloid": "Amyloid", "length": "100", "remarks": "Conformation of Amyloid Fibrils of beta2-Microglobulin Probed by Tryptophan Mutagenesis", "protein_name": "Beta-2-microglobulin", "peptide_protein_sequence": "chain-ID A: MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDWLKNGERIEKVEHSDLSFSKDFSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKFDRDM", "ligand_name": "SODIUM ION", "ligand_smiles": "[Na+]", "pdb_id": "2D4D", "ec_number": "", "pdb_classification": "IMMUNE SYSTEM", "mutation_s_field": "L39W/W60F/W95F", "ligand_formula": "Na 1", "r_value_free": "0.265", "alternative_name": "", "description": "An x-ray structural analysis revealed that W39-Beta2-m assumes the native fold with Trp39 located in the vicinity of the disulfide bond. Comparison of the fluorescence spectra of various mutants for the native and fibrillar forms indicated that, while the Trp residues introduced in the middle of the Beta2-m sequence tend to be buried in the fibrils, those located in the C-terminal region are more exposed.", "resolution": "2.1", "pmid": "16901902", "entry": "S-0093"}