{"method": "SOLUTION NMR", "mutation_s_field": "No", "ec_number": "", "description": "The high-resolution structure of rat IAPP in the membrane-mimicking detergent micelles composed of dodecylphosphocholine was solved. The structure is characterized by a helical region spanning the residues A5 to S23 and a disordered C-terminus. A distortion in the helix is seen at R18 and S19 that may be involved in receptor binding. Rat IAPP is bound on the surface of the micelle. A comparison to the detergent-bound structures of other IAPP variants indicates that the N-terminal region may play a crucial role in the self-association and toxicity of IAPP by controlling access to the putative dimerization interface on the hydrophobic face of the amphipathic helix.", "ligstr": "NH2:A:H2 N:16.02:AMINO GROUP:[NH2]:InChI=1/H3N/h1H3:QGZKDVFQNNGYKY-UHFFFAOYAF", "pmid": "19456151", "remarks": "Three-Dimensional NMR Structure of Rat Islet Amyloid Polypeptide in DPC micelles; rat IAPP forms transient alpha-helical structures but does not progress further to form amyloid fibrils", "amyloid_non_amyloid": "Non-amyloid", "type": "Peptide", "inchi": "InChI=1/H3N/h1H3", "resolution": "", "species": "Rattus norvegicus", "secondary_structure": "KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYX#CCSSHHHHHHHHHHHHHTTHHHHCSCCSSCSSCSSCCC", "chain_id": "A", "gene_names": "Iapp", "r_value_free": "", "pdb_id": "2KJ7", "reference": "J Am Chem Soc. 2009 Jun 17;131(23):8252-61.", "keyword": "Islet amyloid polypeptide", "protein_name": "Islet amyloid polypeptide", "ligand_formula": "H2 N", "peptide_protein_sequence": "chain-ID A: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYX", "entry": "S-0115", "length": "38", "uniprot_ac": "P12969", "author": "Nanga, R.P., Brender, J.R., Xu, J., Hartman, K., Subramanian, V., Ramamoorthy, A.", "ligand_smiles": "[NH2]", "ligand_mw": "16.02", "alternative_name": "Amylin, Diabetes-associated peptide", "ligand_name": "AMINO GROUP", "pdb_classification": "HORMONE", "global_stoichiometry": "Monomer - A ", "inchi_key": "QGZKDVFQNNGYKY-UHFFFAOYAF", "ligand_id": "NH2"}