{"global_stoichiometry": "Monomer - A ", "ligstr": "", "uniprot_ac": "P04156", "inchi": "", "reference": "PLoS One. 2010 Jul 22;5(7):e11715.", "author": "Ilc, G., Giachin, G., Jaremko, M., Jaremko, L., Benetti, F., Plavec, J., Zhukov, I., Legname, G.", "type": "Protein", "ligand_id": "", "species": "Homo sapiens", "method": "SOLUTION NMR", "keyword": "Major prion protein", "gene_names": "PRNP, ALTPRP, PRIP, PRP", "chain_id": "", "ligand_mw": "", "inchi_key": "", "secondary_structure": "GQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEPMCITQYERESQAYYQRGSSHHHHHH#CCSCCCSCCCCCCCCCCCCSSCCSCCSCCCSCCSSCSSCEECCCCSCCCCCCSSHHHHHHHHHSGGGSCSCCEECCTTSSSCTTHHHHHHHHHHHHHHHHTTGGGTCCCCHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHSCCSSCC", "amyloid_non_amyloid": "Amyloid", "length": "148", "remarks": "Three dimensional structure of HuPrP(90-231 M129 Q212P)", "protein_name": "Major prion protein", "peptide_protein_sequence": "chain-ID A: GQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEPMCITQYERESQAYYQRGSSHHHHHH", "ligand_name": "", "ligand_smiles": "", "pdb_id": "2KUN", "ec_number": "", "pdb_classification": "MEMBRANE PROTEIN", "mutation_s_field": "M129/Q212P", "ligand_formula": "", "r_value_free": "", "alternative_name": "ASCR, PrP27-30, PrP33-35C", "description": "The NMR solution structure of the truncated recombinant human PrP from residue 90 to 231 carrying the Q212P mutation, which is believed to cause Gerstmann-Str\u00c3\u00a4ussler-Scheinker (GSS) syndrome, a familial prion disease. The secondary structure of the Q212P mutant consists of a flexible disordered tail (residues 90-124) and a globular domain (residues 125-231). The substitution of a glutamine by a proline at the position 212 introduces novel structural differences in comparison to the known wild-type PrP structures. The most remarkable differences involve the C-terminal end of the protein and the Beta(2)-Alpha(2) loop region.", "resolution": "", "pmid": "20661422", "entry": "S-0116"}