{"global_stoichiometry": "Monomer - A ", "ligstr": "", "uniprot_ac": "Q04571", "inchi": "", "reference": "Proc Natl Acad Sci U S A. 2012 Apr 3;109(14):E804-11.", "author": "Macindoe, I., Kwan, A.H., Ren, Q., Morris, V.K., Yang, W., Mackay, J.P., Sunde, M.", "type": "Protein", "ligand_id": "", "species": "Neurospora crassa", "method": "SOLUTION NMR", "keyword": "Hydrophobin", "gene_names": "eas, bli-7, ccg-2, NCU08457", "chain_id": "", "ligand_mw": "", "inchi_key": "", "secondary_structure": "SATTIGPNTCSIDDYKPYCCQSMSGSASLGCVVGVIGSQCGASVKCCKDDVTNTGNSGLIINAANCVA#CCEECCTTTSCSSSCEEEEECCCSSCSSEEEEECCTTCEESSEEEEECCSCSSSCSSSEEECSCSBCC", "amyloid_non_amyloid": "Amyloid", "length": "68", "remarks": "Identification of the key regions that drive functional amyloid formation by the fungal hydrophobin EAS", "protein_name": "Hydrophobin", "peptide_protein_sequence": "chain-ID A: SATTIGPNTCSIDDYKPYCCQSMSGSASLGCVVGVIGSQCGASVKCCKDDVTNTGNSGLIINAANCVA", "ligand_name": "", "ligand_smiles": "", "pdb_id": "2LFN", "ec_number": "", "pdb_classification": "STRUCTURAL PROTEIN", "mutation_s_field": "[del]25-39", "ligand_formula": "", "r_value_free": "", "alternative_name": "Blue light-induced protein 7, Clock-controlled gene protein 2, Rodlet protein", "description": "The hydrophobin EAS from the fungus Neurospora crassa forms functional amyloid fibrils called rodlets that facilitate spore formation and dispersal. Self-assembly of EAS into fibrillar rodlets occurs spontaneously at hydrophobic:hydrophilic interfaces and the rodlets further associate laterally to form amphipathic monolayers.", "resolution": "", "pmid": "22308366", "entry": "S-0121"}