{"method": "SOLUTION NMR", "mutation_s_field": "R24G", "ec_number": "", "description": "In order to get a more detailed understanding of the structural and dynamic properties that govern the amyloid fibers formation process, they have determined the solution structure by NMR for the two constructs, showing that the difference in amyloid fibril formation is not due to sequence or structure.", "ligstr": "", "pmid": "25522882", "remarks": "Solution Structure of 6aJl2 and 6aJL2-R24G Amyloidogenics Light Chain Proteins", "amyloid_non_amyloid": "Amyloid", "type": "Protein", "inchi": "", "resolution": "", "species": "Homo sapiens", "secondary_structure": "NFMLTQPHSVSESPGKTVTISCTGSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL#CCEEECCSCEEECTTSCEEEEEEEESSCTTSSCEEEEEECTTSCEEECCBTTTBCCTTSCSCCCEEEETTTTEEEEEECSCCGGGCEEEEEEEECTTCCEEEBCCEEEEEC", "chain_id": "", "gene_names": "V1-22", "r_value_free": "", "pdb_id": "2MKW", "reference": "Biochem Biophys Res Commun. 2015 Jan 9;456(2):695-9.", "keyword": "V1-22 protein", "protein_name": "V1-22 protein", "ligand_formula": "", "peptide_protein_sequence": "chain-ID A: NFMLTQPHSVSESPGKTVTISCTGSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL", "entry": "S-0139", "length": "111", "uniprot_ac": "Q5NV88", "author": "Maya-Martinez, R., Gil-Rodriguez, P., Amero, C.", "ligand_smiles": "", "ligand_mw": "", "alternative_name": "", "ligand_name": "", "pdb_classification": "IMMUNE SYSTEM", "global_stoichiometry": "Monomer - A", "inchi_key": "", "ligand_id": ""}