{"global_stoichiometry": "Monomer - A ", "ligstr": "", "uniprot_ac": "P02766", "inchi": "", "reference": "Nat Struct Mol Biol. 2017 Apr;24(4):407-413.", "author": "Oroz, J., Kim, J.H., Chang, B.J., Zweckstetter, M.", "type": "Protein", "ligand_id": "", "species": "Homo sapiens", "method": "SOLUTION NMR", "keyword": "Transthyretin", "gene_names": "TTR, PALB", "chain_id": "", "ligand_mw": "", "inchi_key": "", "secondary_structure": "GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNPKE#CCSSCCCCSSSSEEEEEETTTTEECSSCEEEEEEECTTSCEEEEEEEECCTTSCCSSCCCGGGSSSSCEEEEEECHHHHHHTTCCCCSSCCEEEECSSSSCCCCCEEEEECCCCSSCCSCCCCCCCC", "amyloid_non_amyloid": "Amyloid", "length": "127", "remarks": "Solution structure of the F87M/L110M variant of transthyretin in the monomeric state; misfolded cytotoxic monomer ", "protein_name": "Transthyretin", "peptide_protein_sequence": "chain-ID A: GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNPKE", "ligand_name": "", "ligand_smiles": "", "pdb_id": "2NBO", "ec_number": "", "pdb_classification": "TRANSPORT PROTEIN", "mutation_s_field": "F87M/L110M", "ligand_formula": "", "r_value_free": "", "alternative_name": "ATTR, Prealbumin, TBPA", "description": "They used nuclear magnetic resonance (NMR) spectroscopy to determine the three-dimensional structure of the misfolded cytotoxic monomer of the amyloidogenic human protein transthyretin, which is characterized by the release of the C-terminal Beta-strand and perturbations of the A-B loop. The misfolded transthyretin monomer, but not the wild-type protein, binds to human Hsp90. In the bound state, the Hsp90 dimer predominantly populates an open conformation, and transthyretin retains its globular structure. The interaction surface for the transthyretin monomer comprises the N-terminal and middle domains of Hsp90 and overlaps with that of the Alzheimer's-disease-related protein tau.", "resolution": "", "pmid": "28218749", "entry": "S-0152"}