{"method": "SOLUTION NMR", "mutation_s_field": "T119M", "ec_number": "", "description": "They determined the solution structure of a transthyretin monomer that carries the clinically important T119M mutation. The structure displays a non-native arrangement that is distinct from all known structures of transthyretin and highlights the importance of high-resolution studies in solution for understanding molecular processes that lead to amyloid diseases. A TTR mutation T119M has a high frequency of occurrence in the Portuguese population and it protects heterozygous individuals from TTR amyloid disease.", "ligstr": "", "pmid": "27885756", "remarks": "Structure of Monomeric Transthyretin Carrying the Clinically Important T119M Mutation", "amyloid_non_amyloid": "Non-amyloid", "type": "Protein", "inchi": "", "resolution": "", "species": "Homo sapiens", "secondary_structure": "GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTMAVVTNPKE#CCSCCSCCSSSEEEEEEETTTCSBCSSCCEEEEEECTTSCEEEEEEECCCTTCEECCSCCTTTCCSSEEEEEECHHHHHHHHTCCCCSSCEEEEEECSCCCSSCEEEEEEECSSSCCEEECCCCCCC", "chain_id": "", "gene_names": "TTR, PALB", "r_value_free": "", "pdb_id": "2NBP", "reference": "Angew Chem Int Ed Engl. 2016 Dec 23;55(52):16168-16171.", "keyword": "Transthyretin", "protein_name": "Transthyretin", "ligand_formula": "", "peptide_protein_sequence": "chain-ID A: GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTMAVVTNPKE", "entry": "S-0153", "length": "127", "uniprot_ac": "P02766", "author": "Kim, J.H., Oroz, J., Zweckstetter, M.", "ligand_smiles": "", "ligand_mw": "", "alternative_name": "ATTR, Prealbumin, TBPA", "ligand_name": "", "pdb_classification": "TRANSPORT PROTEIN", "global_stoichiometry": "Monomer - A ", "inchi_key": "", "ligand_id": ""}