{"global_stoichiometry": "Homo 4-mer - A4 ", "ligstr": "", "uniprot_ac": "O14776", "inchi": "", "reference": "Proc Natl Acad Sci U S A. 2006 Oct 31;103(44):16248-53. Epub  2006 Oct 23", "author": "Ferguson, N., Becker, J., Tidow, H., Tremmel, S., Sharpe, T.D., Krause, G., Flinders, J., Petrovich, M., Berriman, J., Oschkinat, H., Fersht, A.R.", "type": "Fibril", "ligand_id": "", "species": "Homo sapiens", "method": "SOLID-STATE NMR", "keyword": "Transcription elongation regulator 1", "gene_names": "TCERG1, CA150, TAF2S", "chain_id": "", "ligand_mw": "", "inchi_key": "", "secondary_structure": "GSMGATAVSEWTEYKTADGKTFYYNNRTLESTWEKPQELK#CCCCEEEEEEEEEECCSSSCCEEEEEEEEESCCCCCCCCC&GSMGATAVSEWTEYKTADGKTFYYNNRTLESTWEKPQELK#CCCCEEEEEEEEEEECCSTTCEEEEEEEEECCCCCCCCCC&GSMGATAVSEWTEYKTADGKTFYYNNRTLESTWEKPQELK#CCCCEEEEEEEEEEEEEETTCEEEEEEEEECCCCCCCCCC&GSMGATAVSEWTEYKTADGKTFYYNNRTLESTWEKPQELK#CCCCEEEEEEEEEEEEEECCCEEEEEEEEESCCCCCCCCC", "amyloid_non_amyloid": "Amyloid", "length": "40", "remarks": "General structural motifs of amyloid protofilaments", "protein_name": "Transcription elongation regulator 1", "peptide_protein_sequence": "chain-ID A: GSMGATAVSEWTEYKTADGKTFYYNNRTLESTWEKPQELK; chain-ID B: GSMGATAVSEWTEYKTADGKTFYYNNRTLESTWEKPQELK; chain-ID C: GSMGATAVSEWTEYKTADGKTFYYNNRTLESTWEKPQELK; chain-ID D: GSMGATAVSEWTEYKTADGKTFYYNNRTLESTWEKPQELK", "ligand_name": "", "ligand_smiles": "", "pdb_id": "2NNT", "ec_number": "", "pdb_classification": "PROTEIN FIBRIL", "mutation_s_field": "No", "ligand_formula": "", "r_value_free": "", "alternative_name": "TATA box-binding protein-associated factor 2S, Transcription factor CA150", "description": "\"Human CA150, a transcriptional activator, binds to and is co-deposited with huntingtin during Huntington's disease. The second WW domain of CA150 is a three-stranded Beta-sheet that folds in vitro in microseconds and forms amyloid fibers under physiological conditions. The structure has similarities to the hairpin formed by the A(Beta)((1-40)) protofilament, yet also contains closely packed side-chains in a \"\"steric zipper\"\" arrangement found in the cross-Beta spine formed from small peptides from the Sup35 prion protein. \"", "resolution": "", "pmid": "17060612", "entry": "S-0154"}