{"method": "X-RAY DIFFRACTION", "mutation_s_field": "No", "ec_number": "", "description": "The tetrameric structure of stefin B is the result of a process by which two domain-swapped dimers of stefin B are transformed into tetramers. The transformation involves a previously unidentified process of extensive intermolecular contacts, termed hand shaking, which occurs concurrently with trans to cis isomerization of proline 74. This proline residue is widely conserved throughout the cystatin superfamily, a member of which, human cystatin C, is the key protein in cerebral amyloid angiopathy. These results are consistent with the hypothesis that isomerization of proline residues can play a decisive role in amyloidogenesis.", "ligstr": "", "pmid": "17217964", "remarks": "Stefin B (Cystatin B) tetramer", "amyloid_non_amyloid": "Amyloid", "type": "Protein", "inchi": "", "resolution": "1.4", "species": "Homo sapiens", "secondary_structure": "MMSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKSLTLSNYQTNKAKHDELTYF#CCCSSCCCCEECCHHHHHHHHHHHHHHHHHHTSCCSCCEEEEEEEEEEEEEEEEEEEECSTTCEEEEEEEEESSTTCCCEEEEEEEEEECTTCCCCCC&MMSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKSLTLSNYQTNKAKHDELTYF#CCCCCCCCCEECCHHHHHHHHHHHHHHHHHHCCCCSCCEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEESSTTCCCEEEEEEEEEECTTCCCCCC", "chain_id": "", "gene_names": "CSTB, CST6, STFB", "r_value_free": "0.18899999", "pdb_id": "2OCT", "reference": "J Mol Biol. 2007 Mar 9;366(5):1569-79. Epub  2006 Dec 16", "keyword": "Cystatin B", "protein_name": "Cystatin-B", "ligand_formula": "", "peptide_protein_sequence": "chain-ID A: MMSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKSLTLSNYQTNKAKHDELTYF; chain-ID B: MMSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKSLTLSNYQTNKAKHDELTYF", "entry": "S-0156", "length": "98", "uniprot_ac": "P04080", "author": "Jenko Kokalj, S., Guncar, G., Stern, I., Morgan, G., Rabzelj, S., Kenig, M., Staniforth, R.A., Waltho, J.P., Zerovnik, E., Turk, D.", "ligand_smiles": "", "ligand_mw": "", "alternative_name": "CPI-B, Liver thiol proteinase inhibitor, Stefin-B", "ligand_name": "", "pdb_classification": "PROTEIN BINDING", "global_stoichiometry": "Homo 4-mer - A4 ", "inchi_key": "", "ligand_id": ""}