{"method": "SOLUTION NMR", "mutation_s_field": "W60G ", "ec_number": "", "description": "The Trp60-->Gly mutation has a threefold effect on Beta(2)m: it stabilizes Beta(2)m, inhibits Beta(2)m amyloidogenic propensity and weakens the interaction with the class I major histocompatibility complex heavy chain. Solution NMR structure.", "ligstr": "", "pmid": "18395224", "remarks": "Solution structure of W60G mutant of human beta2-microglobulin", "amyloid_non_amyloid": "Non-amyloid", "type": "Protein", "inchi": "", "resolution": "", "species": "Homo sapiens", "secondary_structure": "MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDGSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM#CCCCCCBCCEEESSCCCTTSCEEEEEEEECCSSSCCEECCEETTEECSCCEECCCCBSSSSCBEEEEECEECCCSSCCEEEEEECTTTCSCCEEECBCCC", "chain_id": "", "gene_names": "B2M, CDABP0092, HDCMA22P", "r_value_free": "", "pdb_id": "2VB5", "reference": "J Mol Biol. 2008 May 9;378(4):887-97.", "keyword": "BETA-2-MICROGLOBULIN", "protein_name": "Beta-2-microglobulin", "ligand_formula": "", "peptide_protein_sequence": "chain-ID A: MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDGSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM", "entry": "S-0175", "length": "100", "uniprot_ac": "P61769", "author": "Esposito, G., Ricagno, S., Corazza, A., Rennella, E., Gumral, D., Mimmi, M.C., Betto, E., Pucillo, C.E.M., Fogolari, F., Viglino, P., Raimondi, S., Giorgetti, S., Bolognesi, B., Merlini, G., Stoppini, M., Bolognesi, M., Bellotti, V.", "ligand_smiles": "", "ligand_mw": "", "alternative_name": "", "ligand_name": "", "pdb_classification": "IMMUNE SYSTEM", "global_stoichiometry": "Monomer - A ", "inchi_key": "", "ligand_id": ""}