{"resolution": "", "ligand_mw": "", "secondary_structure": "MIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM#CCEEEESSCCCTTCCEEEEEECCSSCGGGEEEEEEETTEECCCBCCCCCCTTTCCCSCCEECBEECCCSSCCEEEEEEESSCSSCEEEECTTCC", "inchi": "", "method": "SOLUTION NMR", "ec_number": "", "uniprot_ac": "P61769", "remarks": "Prion-like conversion during amyloid formation at atomic resolution", "description": "Prion-like conversion during amyloid formation at atomic resolution. They use ?N6, a truncation variant of the naturally amyloidogenic protein Beta(2)-microglobulin (Beta(2)m), to determine the solution structure of a nonnative amyloidogenic intermediate at high resolution. The structure of ?N6 reveals a major repacking of the hydrophobic core to accommodate the nonnative peptidyl-prolyl trans-isomer at Pro32. These structural changes, together with a concomitant pH-dependent enhancement in backbone dynamics on a microsecond-millisecond timescale, give rise to a rare conformer with increased amyloidogenic potential.", "type": "Protein", "ligand_smiles": "", "chain_id": "", "species": "Homo sapiens", "keyword": "BETA-2-MICROGLOBULIN", "ligstr": "", "pmid": "21255727", "mutation_s_field": "[del]N-terminal (6)", "author": "Eichner, T., Kalverda, A.P., Thompson, G.S., Homans, S.W., Radford, S.E.", "pdb_id": "2XKU", "amyloid_non_amyloid": "Amyloid", "inchi_key": "", "ligand_name": "", "ligand_formula": "", "ligand_id": "", "r_value_free": "", "protein_name": "Beta-2-microglobulin", "gene_names": "B2M, CDABP0092, HDCMA22P", "global_stoichiometry": "Monomer - A ", "alternative_name": "", "peptide_protein_sequence": "chain-ID A: MIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM", "pdb_classification": "IMMUNE SYSTEM", "reference": "Mol Cell. 2011 Jan 21;41(2):161-72.", "length": "94", "entry": "S-0177"}