{"reference": "J Mol Biol. 2008 May 9;378(4):887-97.", "alternative_name": "", "entry": "S-0183", "gene_names": "B2M, CDABP0092, HDCMA22P", "remarks": "Crystal structure of the human beta-2 microglobulin mutant W60G", "secondary_structure": "MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDGSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM#CCCBCCEEEEEEECCTTCTTCEEEEEEEEEEBSSCCEEEEEETTEECSCCCEEEEEECTTSCEEEEEEEEECCCTTCCEEEEEECTTCSSCEEEECCTTC", "chain_id": "", "inchi": "", "amyloid_non_amyloid": "Non-amyloid", "pmid": "18395224", "ligand_smiles": "", "keyword": "Beta-2-microglobulin", "peptide_protein_sequence": "chain-ID A: MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDGSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM", "uniprot_ac": "P61769", "protein_name": "Beta-2-microglobulin", "r_value_free": "0.214", "mutation_s_field": "W60G ", "ligand_mw": "", "pdb_id": "2Z9T", "inchi_key": "", "ec_number": "", "pdb_classification": "IMMUNE SYSTEM", "type": "Protein", "author": "Esposito, G., Ricagno, S., Corazza, A., Rennella, E., Gumral, D., Mimmi, M.C., Betto, E., Pucillo, C.E.M., Fogolari, F., Viglino, P., Raimondi, S., Giorgetti, S., Bolognesi, B., Merlini, G., Stoppini, M., Bolognesi, M., Bellotti, V.", "species": "Homo sapiens", "ligand_id": "", "method": "X-RAY DIFFRACTION", "ligand_name": "", "global_stoichiometry": "Monomer - A ", "resolution": "1.8", "ligand_formula": "", "length": "100", "ligstr": "", "description": "The Trp60-->Gly mutation has a threefold effect on Beta(2)m: it stabilizes Beta(2)m, inhibits Beta(2)m amyloidogenic propensity and weakens the interaction with the class I major histocompatibility complex heavy chain. Crystal structure."}