{"reference": "J Mol Biol. 2009 May 29;389(1):199-210.", "alternative_name": "", "entry": "S-0221", "gene_names": "", "remarks": "Structure of amyloidogenic kappa 1 Bence Jones protein", "secondary_structure": "DIQMTQSPSSLSASVGDRVTITCQASQDITNHLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGRGSGTHFTFTISSLQPADIATYYCQEYDYLPQTFGGGTKVEIK#CCCEEEECSEEEECTTCCEEEEEEESSCCTTCEEEEEECTTSCCEEEEETTTEECTTCCTTEEEEECSSEEEEEESSCCGGGCEEEEEEECSSSSCCBCCCEEEEEC", "chain_id": "", "inchi": "", "amyloid_non_amyloid": "Amyloid", "pmid": "19361523", "ligand_smiles": "", "keyword": "Amyloidogenic immunoglobulin light chain protein AL-12", "peptide_protein_sequence": "chain-ID A: DIQMTQSPSSLSASVGDRVTITCQASQDITNHLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGRGSGTHFTFTISSLQPADIATYYCQEYDYLPQTFGGGTKVEIK", "uniprot_ac": "", "protein_name": "Immunoglobin kappa 1 Bence Jones protein", "r_value_free": "0.266", "mutation_s_field": "No", "ligand_mw": "", "pdb_id": "3DVF", "inchi_key": "", "ec_number": "", "pdb_classification": "PROTEIN FIBRIL", "type": "Protein", "author": "Randles, E.G., Thompson, J.R., Martin, D.J., Ramirez-Alvarado, M.", "species": "Homo sapiens", "ligand_id": "", "method": "X-RAY DIFFRACTION", "ligand_name": "", "global_stoichiometry": "Homo 2-mer - A2 ", "resolution": "1.8", "ligand_formula": "", "length": "107", "ligstr": "", "description": "Structure of amyloidogenic kappa 1 Bence Jones protein. They highlight important structural alterations in two loops flanking the dimer interface and correlate these results with the somatic mutations present in AL-12 and AL-103. These alterations are informative structural features that are likely contributing to protein instability that leads to conformational changes involved in the initial events of amyloid formation."}