{"resolution": "1.53", "ligand_mw": "", "secondary_structure": "TDIQMTQSPSSLSASVGDRVTITCQASQDISNYLIWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYHNLPPYTFGPGTKLEIK#CCCCEEEECSEEEECTTCCEEEEEEESSCCTTCEEEEEECTTSCCEEEEETTTEECTTSCTTEEEECSSSEEEEEESSCCGGGCEEEEEEECSSSSCCCBCCCEEEEEC", "inchi": "", "method": "X-RAY DIFFRACTION", "ec_number": "", "uniprot_ac": "", "remarks": "Crystal structure of kappa 1 amyloidogenic light chain variable domain", "description": "Crystal structure of kappa 1 amyloidogenic light chain variable domain. They highlight important structural alterations in two loops flanking the dimer interface and correlate these results with the somatic mutations present in AL-12 and AL-103. These alterations are informative structural features that are likely contributing to protein instability that leads to conformational changes involved in the initial events of amyloid formation.", "type": "Fibril", "ligand_smiles": "", "chain_id": "", "species": "Homo sapiens", "keyword": "Amyloidogenic light chain variable domain AL-103", "ligstr": "", "pmid": "19361523", "mutation_s_field": "No", "author": "Randles, E.G., Thompson, J.R., Martin, D.J., Ramirez-Alvarado, M.", "pdb_id": "3DVI", "amyloid_non_amyloid": "Amyloid", "inchi_key": "", "ligand_name": "", "ligand_formula": "", "ligand_id": "", "r_value_free": "0.251", "protein_name": "Immunoglobin kappa 1 light chain", "gene_names": "", "global_stoichiometry": "Homo 2-mer - A2 ", "alternative_name": "", "peptide_protein_sequence": "chain-ID A: TDIQMTQSPSSLSASVGDRVTITCQASQDISNYLIWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYHNLPPYTFGPGTKLEIK", "pdb_classification": "PROTEIN FIBRIL", "reference": "J Mol Biol. 2009 May 29;389(1):199-210.", "length": "109", "entry": "S-0222"}