{"method": "SOLUTION NMR", "mutation_s_field": "No", "ec_number": "", "description": "They engineered a class of binding proteins termed Beta-wrapins (Beta-wrap proteins) with affinity for Alpha-synuclein. The NMR structure of an Alpha-syn:Beta-wrapin complex reveals a Beta-hairpin of Alpha-syn comprising the sequence region Alpha-syn(37-54). The Beta-wrapin inhibits Alpha-syn aggregation and toxicity at substoichiometric concentrations, demonstrating that it interferes with the nucleation of aggregation. ", "ligstr": "", "pmid": "24623599", "remarks": "Structure of alpha-synuclein in complex with an engineered binding protein", "amyloid_non_amyloid": "Non-amyloid", "type": "Inhibitor complex", "inchi": "", "resolution": "", "species": "", "secondary_structure": "DGEIFYLPNLNPDQLCAFFHSVHDDPSQSANLLAEAKKLNDAQAPK#CCEEEECTTSCHHHHHHHHHHHHHCTTSHHHHHHHHHHHHHHHCCC&DGEIFYLPNLNPDQLCAFFHSVHDDPSQSANLLAEAKKLNDAQAPK#CCEEEECSSCCHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHHSCCC&EGVLYVGSKTKEGVVHGVATVA#CEEEEEEEECSSSCEEEEEEEC", "chain_id": "", "gene_names": "SNCA, NACP, PARK1", "r_value_free": "", "pdb_id": "4BXL", "reference": "Angew Chem Int Ed Engl. 2014 Apr 14;53(16):4227-30.", "keyword": "", "protein_name": "Alpha-synuclein", "ligand_formula": "", "peptide_protein_sequence": "chain-ID A: DGEIFYLPNLNPDQLCAFFHSVHDDPSQSANLLAEAKKLNDAQAPK; chain-ID B: DGEIFYLPNLNPDQLCAFFHSVHDDPSQSANLLAEAKKLNDAQAPK; chain-ID C: EGVLYVGSKTKEGVVHGVATVA", "entry": "S-0309", "length": "46 ,  22", "uniprot_ac": "", "author": "Mirecka, E.A., Shaykhalishahi, H., Gauhar, A., Akgul, S., Lecher, J., Willbold, D., Stoldt, M., Hoyer, W.", "ligand_smiles": "", "ligand_mw": "", "alternative_name": "Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor", "ligand_name": "", "pdb_classification": "FIBRIL", "global_stoichiometry": "Hetero 3-mer - A2B", "inchi_key": "", "ligand_id": ""}