{"global_stoichiometry": "Homo 2-mer - A2 ", "ligstr": "SIN:A:C4 H6 O4:118.09:SUCCINIC ACID:C(CC(=O)O)C(=O)O:InChI=1S/C4H6O4/c5-3(6)1-2-4(7)8/h1-2H2,(H,5,6)(H,7,8):KDYFGRWQOYBRFD-UHFFFAOYSA-N", "uniprot_ac": "", "inchi": "InChI=1S/C4H6O4/c5-3(6)1-2-4(7)8/h1-2H2,(H,5,6)(H,7,8)", "reference": "Proc Natl Acad Sci U S A. 2014 Apr 22;111(16):E1562-70.", "author": "Hochberg, G.K., Ecroyd, H., Liu, C., Cox, D., Cascio, D., Sawaya, M.R., Collier, M.P., Stroud, J., Carver, J.A., Baldwin, A.J., Robinson, C.V., Eisenberg, D.S., Benesch, J.L., Laganowsky, A.", "type": "Inhibitor complex", "ligand_id": "SIN", "species": "", "method": "X-RAY DIFFRACTION", "keyword": "", "gene_names": "CRYAB, CRYA2, HSPB5", "chain_id": "A", "ligand_mw": "118.09", "inchi_key": "KDYFGRWQOYBRFD-UHFFFAOYSA-N", "secondary_structure": "GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVS#CEEECSSEEEEEEECTTSCGGGEEEEEETTEEEEEEEEEEEEETTEEEEEEEEEEEECCTTSCGGGCEEEECTTSEEEEEEECCCCC&GERTIPITRE#CCEECCEECC", "amyloid_non_amyloid": "Non-amyloid", "length": "87 ,  10", "remarks": "Human alphaB crystallin core domain in complex with C-terminal peptide; The structured core domain of alpha B-crystallin can prevent amyloid fibrillation and associated toxicity.", "protein_name": "alphaB crystallin", "peptide_protein_sequence": "chain-ID A: GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVS; chain-ID B: GERTIPITRE", "ligand_name": "SUCCINIC ACID", "ligand_smiles": "C(CC(=O)O)C(=O)O", "pdb_id": "4M5S", "ec_number": "", "pdb_classification": "CHAPERONE", "mutation_s_field": "No", "ligand_formula": "C4 H6 O4", "r_value_free": "0.187", "alternative_name": "Alpha(B)-crystallin, Heat shock protein beta-5, Renal carcinoma antigen NY-REN-27, Rosenthal fiber component", "description": "The structures of  small heat-shock protein's core domains (cABC, cHSP27), each in complex with a segment of their respective C-terminal regions. Both truncated proteins dimerize, and although this interface is labile in the case of cABC, in cHSP27 the dimer can be cross-linked by an intermonomer disulfide linkage.", "resolution": "1.37", "pmid": "24711386", "entry": "S-0338"}