{"global_stoichiometry": "Monomer - A", "ligstr": "", "uniprot_ac": "P61769", "inchi": "", "reference": "Sci Rep. 2016 May 6;6:25559.", "author": "Camilloni, C., Sala, B.M., Sormanni, P., Porcari, R., Corazza, A., De Rosa, M., Zanini, S., Barbiroli, A., Esposito, G., Bolognesi, M., Bellotti, V., Vendruscolo, M., Ricagno, S.", "type": "Protein", "ligand_id": "", "species": "Homo sapiens", "method": "X-RAY DIFFRACTION", "keyword": "Beta-2-microglobulin", "gene_names": "B2M, CDABP0092, HDCMA22P", "chain_id": "", "ligand_mw": "", "inchi_key": "", "secondary_structure": "MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDGSFWLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM#CCCBCCEEEEEESSCCCTTSCEEEEEEEEEEBSSCCEEEEEETTEECSCCCEEEEEECTTSCEEEEEEEEECCCSSCCEEEEEECTTCSSCEEEECCCCC", "amyloid_non_amyloid": "Amyloid", "length": "100", "remarks": "human beta-2 microglobulin double mutant W60G-Y63W", "protein_name": "Beta-2-microglobulin", "peptide_protein_sequence": "chain-ID A: MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDGSFWLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM", "ligand_name": "", "ligand_smiles": "", "pdb_id": "5CFH", "ec_number": "", "pdb_classification": "IMMUNE SYSTEM", "mutation_s_field": "W60G/Y63W", "ligand_formula": "", "r_value_free": "0.23", "alternative_name": "", "description": "They compare the native state dynamics of Beta-2 microglobulin (Beta2m), whose aggregation is associated with dialysis-related amyloidosis, and its aggregation-resistant mutant W60G. Their results indicate that W60G low aggregation propensity can be explained, beyond its higher stability, by an increased average protection of the aggregation-prone residues at its surface. To validate these findings, They designed Beta2m variants that alter the aggregation-prone exposed surface of wild-type and W60G Beta2m modifying their aggregation propensity. the W60G Beta 2m variant (W60G-Y63W and W60G-N83V) are expected to weakly (the former) or largely (the latter) increase the W60G aggregation propensity.", "resolution": "1.49", "pmid": "27150430", "entry": "S-0419"}